PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01435.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 356aa    MW: 39727.2 Da    PI: 8.0179
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01435.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.1e-161465148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....TTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg....kgRtlkqcksrwqkyl 48
                             +g W++eEde+l++ ++ +G g+W+++++       + R++k+c++rw +yl
  Rsa1.0_01435.1_g00002.1 14 KGLWSPEEDEKLLNHITIHGHGCWSSVPKLAEsatgLQRCGKSCRLRWINYL 65
                             678***********************************************97 PP

2Myb_DNA-binding47.73.6e-1571113145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              rg++++eE+ l+v++++ lG++ W+ Ia++++ gRt++++k+ w+
  Rsa1.0_01435.1_g00002.1  71 RGAFSPEEESLIVELHAVLGNR-WSQIAARLP-GRTDNEIKNLWN 113
                              89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25668IPR009057Homeodomain-like
PROSITE profilePS5129415.613965IPR017930Myb domain
SuperFamilySSF466892.7E-2812112IPR009057Homeodomain-like
SMARTSM007171.6E-111367IPR001005SANT/Myb domain
PfamPF002492.0E-131465IPR001005SANT/Myb domain
CDDcd001671.81E-101765No hitNo description
PROSITE profilePS5129424.57966120IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2569120IPR009057Homeodomain-like
SMARTSM007174.4E-1370118IPR001005SANT/Myb domain
PfamPF002498.6E-1471113IPR001005SANT/Myb domain
CDDcd001675.97E-1073113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNHIT IHGHGCWSSV PKLAESATGL QRCGKSCRLR  60
WINYLRPDLK RGAFSPEEES LIVELHAVLG NRWSQIAARL PGRTDNEIKN LWNSSIKKKL  120
RQRGIDPNTH KPISEVDKDK PTRSSNNDHK SPSSSAATNQ DFFLERPSDF SDYFGLQKLN  180
FNSNLGLSAT PESSLCTMIP GQFSPGNMVG SVFQTQVCVK PSISLPPDSS SSTVSRGDHA  240
ASNWEFQTNN TSNFFDNGGF SWPIANPSSS VVKPNHNFEE VKWSEYLNTP FFNGSTVQSQ  300
NSQQICIKSE AEYLAKVSNM TDPWSQSQNE NLGTPEASDV FSKDLQRMAV SFGQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27121205108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893310.0AC189331.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037O12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110822.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A078H0U70.0A0A078H0U7_BRANA; BnaA08g26320D protein
STRINGBra030783.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.10.0myb domain protein 61